// NMR / fragment screening · Protein pipeline, Phase 6 evidence layer

FKBP12

108 aa (P62942) · predicted structure regenerated live for this page (AlphaFold DB + ANM ensemble + fpocket + cross-frame ranker, same pipeline as every worked example on this site).

// Independently verified against a real PDB structure — not pipeline output

Independently checked against PDB 1FKJ (FK506-bound — the textbook NMR/fragment-screening pocket). The real pocket (His87 and Ile91 match exactly, several adjacent loop residues close) shows up at rank 2 (persistence 0.6), not rank 1 — rank 1 is a different region near the N-terminus. This was the batch's own designated sanity anchor; the correct answer is present, just demoted. Structural check: CA RMSD vs. 1FKJ is 0.53 Å whole-chain, 0.57 Å within the pocket — near-experimental accuracy on this small, single-domain target.

Rank 1 Rank 2 Rank 3

// Sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Length108 aa
UniProtP62942
Mean structure confidence0.9627
Pocket clusters3
Numbering cross-walk107/108 vs. 2PPN

// Findings

Family, precedent, and provenance

Family classification

returned data

FKBP_C (PF00254) — FKBP-type peptidyl-prolyl cis-trans isomerase

E=4.30e-37 · bit score 127.0 · passes GA threshold: yes

Known ligand precedent

returned data

439 total structures in family · 8 distinct ligand scaffolds curated

  • 7AOT — RTQ
  • 7APW — RSB
  • 8R5K — Y6Z
  • 7APS — RR5
  • 6TX6 — NCA

Conservation

returned data

126 seed sequences · mean pairwise identity 31.4%

Similar known proteins

returned data
  • 8X6P — 100.0% identity · (none)
  • 2PPN — 98.1% identity · (none)
  • 6YF3 — 97.2% identity · CD, OOZ
  • 6YF2 — 97.2% identity · CD, OP5
  • 6YF1 — 97.2% identity · OP8

Structure-based (Foldseek)

  • 4N19 — TM 1.000 · 98% id
  • 8PPZ — TM 1.000 · 99% id (new vs. sequence list)
  • 4IPX — TM 1.000 · 98% id (new vs. sequence list)
  • 6M4W — TM 1.000 · 100% id (new vs. sequence list)
  • 8VK3 — TM 0.999 · 97% id (new vs. sequence list)

Interaction fingerprints (Evidence Integration Layer)

returned data

Representative complex: 6YF3 (OOZ, 1.00 Å)

Residue (PDB)Residue (pipeline)InteractionPartner
3738hydrogen bondASP37 (hydrogen bond) with ligand OOZ
5455hydrogen bondGLU54 (hydrogen bond) with ligand OOZ
5657hydrogen bondILE56 (hydrogen bond) with ligand OOZ
2627hydrophobicTYR26 (hydrophobic) with ligand OOZ
3637hydrophobicPHE36 (hydrophobic) with ligand OOZ
4647hydrophobicPHE46 (hydrophobic) with ligand OOZ
4647hydrophobicPHE46 (hydrophobic) with ligand OOZ
5657hydrophobicILE56 (hydrophobic) with ligand OOZ
5960hydrophobicTRP59 (hydrophobic) with ligand OOZ
9091hydrophobicILE90 (hydrophobic) with ligand OOZ
4647hydrophobicPHE46 (hydrophobic) with ligand OOZ
5960hydrophobicTRP59 (hydrophobic) with ligand OOZ

Representative complex: 6YF2 (OP5, 1.03 Å)

Residue (PDB)Residue (pipeline)InteractionPartner
3738hydrogen bondASP37 (hydrogen bond) with ligand OP5
5455hydrogen bondGLU54 (hydrogen bond) with ligand OP5
5657hydrogen bondILE56 (hydrogen bond) with ligand OP5
2627hydrophobicTYR26 (hydrophobic) with ligand OP5
4647hydrophobicPHE46 (hydrophobic) with ligand OP5
4647hydrophobicPHE46 (hydrophobic) with ligand OP5
4647hydrophobicPHE46 (hydrophobic) with ligand OP5
5657hydrophobicILE56 (hydrophobic) with ligand OP5
5960hydrophobicTRP59 (hydrophobic) with ligand OP5
5960hydrophobicTRP59 (hydrophobic) with ligand OP5
8283hydrophobicTYR82 (hydrophobic) with ligand OP5
9192hydrophobicILE91 (hydrophobic) with ligand OP5

Representative complex: 6YF1 (OP8, 1.12 Å)

Residue (PDB)Residue (pipeline)InteractionPartner
3738hydrogen bondASP37 (hydrogen bond) with ligand OP8
2627hydrogen bondTYR26 (hydrogen bond) with ligand OP8
8283hydrogen bondTYR82 (hydrogen bond) with ligand OP8
5657hydrogen bondILE56 (hydrogen bond) with ligand OP8
2627hydrophobicTYR26 (hydrophobic) with ligand OP8
3637hydrophobicPHE36 (hydrophobic) with ligand OP8
4647hydrophobicPHE46 (hydrophobic) with ligand OP8
5556hydrophobicVAL55 (hydrophobic) with ligand OP8
5657hydrophobicILE56 (hydrophobic) with ligand OP8
5960hydrophobicTRP59 (hydrophobic) with ligand OP8
9192hydrophobicILE91 (hydrophobic) with ligand OP8
4647hydrophobicPHE46 (hydrophobic) with ligand OP8
5960hydrophobicTRP59 (hydrophobic) with ligand OP8
8283hydrophobicTYR82 (hydrophobic) with ligand OP8
8586water bridgeTHR85 (water bridge) with ligand OP8

Structural analysis — ranked pocket clusters

returned data

Residue numbers below are pipeline-sequential, with the literature (author-deposited PDB 2PPN) number shown in parentheses — 107/108 residues cross-walked.

RankPersistenceResidues
#10.81(?), 2(1), 3(2), 4(3), 32(31), 76(75), 78(77), 79(78), 97(96)
#20.631(30), 35(34), 86(85), 88(87), 89(88), 90(89), 91(90), 92(91), 93(92), 94(93)
#30.819(18), 51(50), 52(51), 53(52), 54(53), 61(60), 62(61), 65(64)

Pocket residues overlapping known interaction sites

  • Pocket 1: no overlap with known interaction sites (9 checked)
  • Pocket 2: residues 86, 91, 92 (3 of 10 pocket residues match a known interaction site)
  • Pocket 3: no overlap with known interaction sites (8 checked)

Pocket functional context (UniProt + ClinVar)

Pocket 1

no UniProt functional features or ClinVar variants overlap with pocket residues

Pocket 2

no UniProt functional features or ClinVar variants overlap with pocket residues

Pocket 3

  • Residue 53: Modified residue — N6-acetyllysine; alternate
  • Residue 53: Modified residue — N6-succinyllysine; alternate

// Limitations & data provenance

Auto-populated from each section’s own status — not hand-maintained.

Family classificationreturned data
Known ligand precedentreturned data
Interaction fingerprintsreturned data
Functional contextreturned data
Conservationreturned data
Structural analysisreturned data
Similar known proteinsreturned data